missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fyn Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | Fyn |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18294293
|
Novus Biologicals
NBP2-57212 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663517
|
Novus Biologicals
NBP2-57212-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Fyn Polyclonal specifically detects Fyn in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Fyn | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Signal Transduction | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2534 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 2.7.10, EC 2.7.10.2, FYN oncogene related to SRC, FGR, YES, MGC45350, OKT3-induced calcium influx regulator, p59-Fyn, protein-tyrosine kinase fyn, Proto-oncogene c-Fyn, Proto-oncogene Syn, proto-oncogene tyrosine-protein kinase fyn, SLKc-syn protooncogene, src/yes-related novel, Src-like kinase, SYN, tyrosine kinase p59fyn(T), tyrosine-protein kinase Fyn | |
| FYN | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title