Fyn Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57212

Product Code. 18294293

Description

Fyn Polyclonal specifically detects Fyn in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Fyn
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.7.10, EC 2.7.10.2, FYN oncogene related to SRC, FGR, YES, MGC45350, OKT3-induced calcium influx regulator, p59-Fyn, protein-tyrosine kinase fyn, Proto-oncogene c-Fyn, Proto-oncogene Syn, proto-oncogene tyrosine-protein kinase fyn, SLKc-syn protooncogene, src/yes-related novel, Src-like kinase, SYN, tyrosine kinase p59fyn(T), tyrosine-protein kinase Fyn
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FYN
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE
• Quantity: 100 μL
• Research Discipline: Protein Kinase, Signal Transduction
• Gene ID (Entrez): 2534
• Target Species: Human
• Isotype: IgG

For Research Use Only