missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Furin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£317.00 - £530.00
Specifications
| Antigen | Furin |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18619883
|
Novus Biologicals
NBP3-21314-100ul |
100 μg |
£530.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18628604
|
Novus Biologicals
NBP3-21314-25ul |
25 μg |
£317.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Furin Polyclonal antibody specifically detects Furin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Furin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Golgi Apparatus Markers, Stem Cell Signaling Pathway | |
| PBS, pH 7.2, 40% glycerol | |
| 5045 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Dibasic-processing enzyme, EC 3.4.21, EC 3.4.21.75, FURdibasic processing enzyme, furin (paired basic amino acid cleaving enzyme), furin, membrane associated receptor protein, PACEFES upstream region, paired basic amino acid cleaving enzyme (furin, membrane associated receptorprotein), Paired basic amino acid residue-cleaving enzyme, PCSK3furin, proprotein convertase subtilisin/kexin type 3, SPC1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title