Furin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-21314-100ul

Product Code. 18619883

Description

Furin Polyclonal antibody specifically detects Furin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Furin
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Dibasic-processing enzyme, EC 3.4.21, EC 3.4.21.75, FURdibasic processing enzyme, furin (paired basic amino acid cleaving enzyme), furin, membrane associated receptor protein, PACEFES upstream region, paired basic amino acid cleaving enzyme (furin, membrane associated receptorprotein), Paired basic amino acid residue-cleaving enzyme, PCSK3furin, proprotein convertase subtilisin/kexin type 3, SPC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI
• Quantity: 100 μg
• Research Discipline: Golgi Apparatus Markers, Stem Cell Signaling Pathway
• Gene ID (Entrez): 5045
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified