missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FUNDC1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£171.00 - £401.00
Specifications
| Antigen | FUNDC1 |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:100 - 1:500 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228434
|
Novus Biologicals
NBP3-33375-100ul |
100 μL |
£401.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232881
|
Novus Biologicals
NBP3-33375-20ul |
20 μL |
£171.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FUNDC1 Monoclonal antibody specifically detects FUNDC1 in Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)Specifications
| FUNDC1 | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Endocrinology | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 139341 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:100 - 1:500 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Rat | |
| FUN14 domain containing 1, FUN14 domain-containing protein 1, MGC51029 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FUNDC1 (NP_776155.1).,, Sequence:, VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title