missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FUNDC1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33375-20ul
This item is not returnable.
View return policy
Description
FUNDC1 Monoclonal antibody specifically detects FUNDC1 in Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
Specifications
| FUNDC1 | |
| Monoclonal | |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:100 - 1:500 | |
| FUN14 domain containing 1, FUN14 domain-containing protein 1, MGC51029 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human FUNDC1 (NP_776155.1).,, Sequence:, VATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFL | |
| 20 μL | |
| Cell Biology, Endocrinology | |
| 139341 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction