missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FTHL17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FTHL17 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FTHL17 Polyclonal specifically detects FTHL17 in Human samples. It is validated for Western Blot.Specifications
| FTHL17 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CT38Cancer/testis antigen 38, ferritin heavy polypeptide-like 17, ferritin, heavy polypeptide-like 17 | |
| FTHL17 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BXU8 | |
| 53940 | |
| Synthetic peptides corresponding to FTHL17(ferritin, heavy polypeptide-like 17) The peptide sequence was selected from the middle region of FTHL17. Peptide sequence FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title