FTHL17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59482

Product Code. 18254972

Description

FTHL17 Polyclonal specifically detects FTHL17 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FTHL17
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CT38Cancer/testis antigen 38, ferritin heavy polypeptide-like 17, ferritin, heavy polypeptide-like 17
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53940
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BXU8
• Gene Symbols: FTHL17
• Immunogen: Synthetic peptides corresponding to FTHL17(ferritin, heavy polypeptide-like 17) The peptide sequence was selected from the middle region of FTHL17. Peptide sequence FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.