missing translation for 'onlineSavingsMsg'
Learn More

FSCN3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£381.00

Specifications

Antigen	FSCN3
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18284666 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-79542	100 μL	£381.00 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

FSCN3 Polyclonal specifically detects FSCN3 in Human samples. It is validated for Western Blot, PCR.

Specifications

Antigen	FSCN3
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotuspurpuratus), fascin-3, testicular), Testis fascin
Gene Symbols	FSCN3
Isotype	IgG
Molecular Weight of Antigen	55 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_065102
Gene ID (Entrez)	29999
Immunogen	Synthetic peptide directed towards the middle region of human FSCN3The immunogen for this antibody is FSCN3. Peptide sequence WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE.
Primary or Secondary	Primary

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

Zurück zum Seitenanfang

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

FSCN3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Dokumentation