missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FoxC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£294.00 - £488.00
Specifications
| Antigen | FoxC2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18262435
|
Novus Biologicals
NBP2-58056 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619006
|
Novus Biologicals
NBP2-58056-25ul |
25 μL |
£294.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FoxC2 Polyclonal specifically detects FoxC2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FoxC2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 2303 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FKHL14LD, forkhead box C2 (MFH-1, mesenchyme forkhead 1), forkhead, Drosophila, homolog-like 14, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, mesenchyme forkhead 1, MFH-1, MFH-1 protein, MFH1forkhead box protein C2, Transcription factor FKH-14 | |
| FOXC2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title