FoxC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58056

Product Code. 18262435

Description

FoxC2 Polyclonal specifically detects FoxC2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FoxC2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FKHL14LD, forkhead box C2 (MFH-1, mesenchyme forkhead 1), forkhead, Drosophila, homolog-like 14, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, mesenchyme forkhead 1, MFH-1, MFH-1 protein, MFH1forkhead box protein C2, Transcription factor FKH-14
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2303
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FOXC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only