missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FosB/G0S3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | FosB/G0S3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18291184
|
Novus Biologicals
NBP2-56210 |
100 μL |
£460.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666226
|
Novus Biologicals
NBP2-56210-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FosB/G0S3 Polyclonal specifically detects FosB/G0S3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FosB/G0S3 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2354 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| activator protein 1, AP-1, DKFZp686C0818, FBJ murine osteosarcoma viral oncogene homolog B, G0S3G0/G1 switch regulatory protein 3, GOS3, GOSB, MGC42291, oncogene FOS-B, protein fosB | |
| FOSB | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title