FosB/G0S3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56210-25ul

Product Code. 18666226

Description

FosB/G0S3 Polyclonal specifically detects FosB/G0S3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FosB/G0S3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: activator protein 1, AP-1, DKFZp686C0818, FBJ murine osteosarcoma viral oncogene homolog B, G0S3G0/G1 switch regulatory protein 3, GOS3, GOSB, MGC42291, oncogene FOS-B, protein fosB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FOSB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAF
• Quantity: 25 μL
• Research Discipline: Cancer, Tumor Suppressors
• Gene ID (Entrez): 2354
• Target Species: Human
• Isotype: IgG

For Research Use Only