missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FMO3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FMO3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FMO3 Polyclonal specifically detects FMO3 in Mouse samples. It is validated for Western Blot.Specifications
| FMO3 | |
| Polyclonal | |
| Rabbit | |
| NP_032056 | |
| 2328 | |
| Synthetic peptide towards Fmo3. Peptide sequence KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dimethylaniline monooxygenase [N-oxide-forming] 3, Dimethylaniline oxidase 3, dJ127D3.1, EC 1.14.13.8, flavin containing monooxygenase 3, FMO 3, FMO form 2, FMO II, FMOII, Hepatic flavin-containing monooxygenase 3, hepatic flavin-containing monooxygenase-3, MGC34400, TMAU | |
| FMO3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title