FMO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82415

Product Code. 18269735

Description

FMO3 Polyclonal specifically detects FMO3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: FMO3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dimethylaniline monooxygenase [N-oxide-forming] 3, Dimethylaniline oxidase 3, dJ127D3.1, EC 1.14.13.8, flavin containing monooxygenase 3, FMO 3, FMO form 2, FMO II, FMOII, Hepatic flavin-containing monooxygenase 3, hepatic flavin-containing monooxygenase-3, MGC34400, TMAU
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2328
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_032056
• Gene Symbols: FMO3
• Immunogen: Synthetic peptide towards Fmo3. Peptide sequence KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Canine: 92%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG