missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FKBP51/FKBP5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £451.00
Specifications
| Antigen | FKBP51/FKBP5 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489240
|
Novus Biologicals
NBP1-84676-25ul |
25 μL |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18248926
|
Novus Biologicals
NBP1-84676 |
0.1 mL |
£451.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FKBP51/FKBP5 Polyclonal specifically detects FKBP51/FKBP5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FKBP51/FKBP5 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, AIG6,51 kDa FK506-binding protein, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP-5, FKBP-51, FKBP51PPIase FKBP5, FKBP54EC 5.2.1.8, HSP90-binding immunophilin, MGC111006, p54, P54,51 kDa FK506-binding protein 5, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP5, PPIase, Ptg-10, rotamase, T-cell FK506-binding protein | |
| FKBP5 | |
| IgG | |
| Affinity Purified | |
| Specificity of human FKBP51/FKBP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2289 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title