missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FKBP51/FKBP5 Antibody, Novus Biologicals™

FKBP51/FKBP5 Antibody, Novus Biologicals™

Product Code. 18489240 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18489240 25 μL 25µL
18248926 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18489240 Supplier Novus Biologicals Supplier No. NBP18467625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

FKBP51/FKBP5 Polyclonal specifically detects FKBP51/FKBP5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FKBP51/FKBP5
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, AIG6,51 kDa FK506-binding protein, Androgen-regulated protein 6, FF1 antigen, FK506 binding protein 5, FK506-binding protein 5, FKBP-5, FKBP-51, FKBP51PPIase FKBP5, FKBP54EC 5.2.1.8, HSP90-binding immunophilin, MGC111006, p54, P54,51 kDa FK506-binding protein 5, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase FKBP5, PPIase, Ptg-10, rotamase, T-cell FK506-binding protein
Gene Symbols FKBP5
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 2289
Test Specificity Specificity of human FKBP51/FKBP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.