missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fetuin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £537.00
Specifications
| Antigen | Fetuin |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18328812
|
Novus Biologicals
NBP3-17712-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18315936
|
Novus Biologicals
NBP3-17712-100UL |
100 μg |
£537.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Fetuin Polyclonal antibody specifically detects Fetuin in Human samples. It is validated for ImmunofluorescenceSpecifications
| Fetuin | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| fetuin B, fetuin-B, Fetuin-like protein IRL685,16G2, Gugu, IRL685 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 26998 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title