missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fetuin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17712-25UL
This item is not returnable.
View return policy
Description
Fetuin Polyclonal antibody specifically detects Fetuin in Human samples. It is validated for Immunofluorescence
Specifications
| Fetuin | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| fetuin B, fetuin-B, Fetuin-like protein IRL685,16G2, Gugu, IRL685 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PSYFVEYLIKESPCTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQK | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 26998 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction