FDFT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54855

Product Code. 18218942

Description

FDFT1 Polyclonal specifically detects FDFT1 in Human, Bovine samples. It is validated for Western Blot.

Specifications

• Antigen: FDFT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DGPT, EC 2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, farnesyl-diphosphate farnesyltransferase 1, FPP:FPP farnesyltransferase, presqualene-di-diphosphate synthase, SQS, squalene synthase, squalene synthetase, SS
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%; Guinea pig: 86%.
• Target Species: Human, Bovine, Rat, Pig, Canine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P37268
• Gene Symbols: FDFT1
• Immunogen: Synthetic peptide directed towards the N terminal of human FDFT1 (NP_004453). Peptide sequence HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2222
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG