missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FDFT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | FDFT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
FDFT1 Polyclonal specifically detects FDFT1 in Human, Bovine samples. It is validated for Western Blot.Specifications
| FDFT1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| DGPT, EC 2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase, farnesyl-diphosphate farnesyltransferase 1, FPP:FPP farnesyltransferase, presqualene-di-diphosphate synthase, SQS, squalene synthase, squalene synthetase, SS | |
| FDFT1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P37268 | |
| 2222 | |
| Synthetic peptide directed towards the N terminal of human FDFT1 (NP_004453). Peptide sequence HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM. | |
| Primary | |
| 48 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title