missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FATP4/SLC27A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£248.00 - £565.00
Specifications
| Antigen | FATP4/SLC27A4 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18604517
|
Novus Biologicals
NBP3-05510-100ul |
100 μg |
£565.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18660977
|
Novus Biologicals
NBP3-05510-25ul |
25 μg |
£248.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FATP4/SLC27A4 Polyclonal antibody specifically detects FATP4/SLC27A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Spécification
| FATP4/SLC27A4 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ACSVL4Solute carrier family 27 member 4, EC 6.2.1, EC 6.2.1.-, EC 6.2.1.7, FATP-4, FATP4Fatty acid transport protein 4, IPS, long-chain fatty acid transport protein 4, solute carrier family 27 (fatty acid transporter), member 4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol | |
| 10999 | |
| IgG | |
| Affinity purified |
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit