missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FATP4/SLC27A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05510-25ul
This item is not returnable.
View return policy
Description
FATP4/SLC27A4 Polyclonal antibody specifically detects FATP4/SLC27A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| FATP4/SLC27A4 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ACSVL4Solute carrier family 27 member 4, EC 6.2.1, EC 6.2.1.-, EC 6.2.1.7, FATP-4, FATP4Fatty acid transport protein 4, IPS, long-chain fatty acid transport protein 4, solute carrier family 27 (fatty acid transporter), member 4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTG | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10999 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction