missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fast skeletal myosin light chain 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | Fast skeletal myosin light chain 1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229448
|
Novus Biologicals
NBP3-38544-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226910
|
Novus Biologicals
NBP3-38544-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Fast skeletal myosin light chain 1 Polyclonal antibody specifically detects Fast skeletal myosin light chain 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| Fast skeletal myosin light chain 1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cellular Markers, Phospho Specific, Vision | |
| PBS (pH 7.3), 50% glycerol | |
| 4632 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| A1 catalytic, A2 catalytic, MLC1/mLC3, MLC1F, MLC1F/mLC3F, MLC3F, myosin light chain 1/3, skeletal muscle isoform, Myosin light chain A1/A2, Myosin light chain alkali 1/2, myosin, light chain 1, alkali; skeletal, fast, myosin, light polypeptide 1, alkali; skeletal, fast | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Fast skeletal myosin light chain 1 (NP_524146.1).,, Sequence:, MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title