missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fast skeletal myosin light chain 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38544-20ul
This item is not returnable.
View return policy
Description
Fast skeletal myosin light chain 1 Polyclonal antibody specifically detects Fast skeletal myosin light chain 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Fast skeletal myosin light chain 1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| A1 catalytic, A2 catalytic, MLC1/mLC3, MLC1F, MLC1F/mLC3F, MLC3F, myosin light chain 1/3, skeletal muscle isoform, Myosin light chain A1/A2, Myosin light chain alkali 1/2, myosin, light chain 1, alkali; skeletal, fast, myosin, light polypeptide 1, alkali; skeletal, fast | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Fast skeletal myosin light chain 1 (NP_524146.1).,, Sequence:, MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI | |
| 20 μL | |
| Cell Biology, Cellular Markers, Phospho Specific, Vision | |
| 4632 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction