missing translation for 'onlineSavingsMsg'
Learn More
Learn More
F-box protein 15/FBXO15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | F-box protein 15/FBXO15 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
F-box protein 15/FBXO15 Polyclonal specifically detects F-box protein 15/FBXO15 in Human samples. It is validated for Western Blot.Specifications
| F-box protein 15/FBXO15 | |
| Polyclonal | |
| Rabbit | |
| Q8NCQ5 | |
| 201456 | |
| Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F-box only protein 15, F-box protein 15, FBX15MGC39671 | |
| FBXO15 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title