F-box protein 15/FBXO15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56901

Product Code. 18254875

Description

F-box protein 15/FBXO15 Polyclonal specifically detects F-box protein 15/FBXO15 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: F-box protein 15/FBXO15
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box only protein 15, F-box protein 15, FBX15MGC39671
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 201456
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NCQ5
• Gene Symbols: FBXO15
• Immunogen: Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 85%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG