missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EYS/RP25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
£294.00 - £452.00
Specifications
| Antigen | EYS/RP25 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 27737822)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Reported in the scientific literature (PMID: 30052645). |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18461902
|
Novus Biologicals
NBP1-90038-25ul |
25 μL |
£294.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18725403
|
Novus Biologicals
NBP1-90038 |
0.1 mL |
£452.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EYS/RP25 Polyclonal specifically detects EYS/RP25 in Human, Zebrafish samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| EYS/RP25 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 346007 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 27737822)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Reported in the scientific literature (PMID: 30052645). | |
| Polyclonal | |
| Rabbit | |
| Human, Zebrafish | |
| C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog | |
| EYS | |
| IgG | |
| Affinity Purified | |
| Specificity of human EYS/RP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title