EYS/RP25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 6 publications

Brand:  Novus Biologicals NBP1-90038-25ul

Product Code. 18461902

Description

EYS/RP25 Polyclonal specifically detects EYS/RP25 in Human, Zebrafish samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: EYS/RP25
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence Reported in scientific literature (PMID 27737822)., Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Reported in the scientific literature (PMID: 30052645).
• Gene Alias: C6orf178, C6orf179, C6orf180, dJ22I17.2, dJ303F19.1, EGFL10, EGFL11, EGF-like-domain, multiple 10, EGF-like-domain, multiple 11, eyes shut homolog (Drosophila), protein spacemaker homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 346007
• Target Species: Human, Zebrafish
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EYS
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGQFCHQRYNLCDLLHNPCR
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human EYS/RP25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only