missing translation for 'onlineSavingsMsg'
Learn More

EXOSC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£222.00 - £470.00

Specifications

Antigen	EXOSC3
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18498571 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-91874-25ul	25 μL	£222.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18465232 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP1-91874	0.1 mL	£470.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

EXOSC3 Polyclonal antibody specifically detects EXOSC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	EXOSC3
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	DNA replication Transcription Translation and Splicing
Formulation	PBS (pH 7.2) and 40% Glycerol
Gene ID (Entrez)	51010
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	bA3J10.7, CGI-102, exosome complex exonuclease RRP40, exosome component 3MGC15120, exosome component Rrp40, hRrp-40, hRrp40p, p10Rrp40p, Ribosomal RNA-processing protein 40, RP11-3J10.8, RRP40MGC723
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

EXOSC3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents