missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EXOD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EXOD1 Polyclonal specifically detects EXOD1 in Human samples. It is validated for Western Blot.Specifications
| EXOD1 | |
| Polyclonal | |
| Rabbit | |
| A8K979 | |
| 112479 | |
| Synthetic peptides corresponding to ERI2(ERI1 exoribonuclease family member 2) The peptide sequence was selected from the middle region of ERI2 (NP_542394). Peptide sequence LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 3.1, ERI1 exoribonuclease 2, ERI1 exoribonuclease family member 2, EXOD1, exonuclease domain containing 1, Exonuclease domain-containing protein 1, exoribonuclease 2, KIAA1504enhanced RNAi three prime mRNA exonuclease homolog 2, MGC16943 | |
| ERI2 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title