EXOD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55303

Product Code. 18210685

Description

EXOD1 Polyclonal specifically detects EXOD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EXOD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1, ERI1 exoribonuclease 2, ERI1 exoribonuclease family member 2, EXOD1, exonuclease domain containing 1, Exonuclease domain-containing protein 1, exoribonuclease 2, KIAA1504enhanced RNAi three prime mRNA exonuclease homolog 2, MGC16943
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 77%; Yeast: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A8K979
• Gene Symbols: ERI2
• Immunogen: Synthetic peptides corresponding to ERI2(ERI1 exoribonuclease family member 2) The peptide sequence was selected from the middle region of ERI2 (NP_542394). Peptide sequence LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 112479
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.