missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ETV7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | ETV7 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18671958
|
Novus Biologicals
NBP2-68687-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615767
|
Novus Biologicals
NBP2-68687 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ETV7 Polyclonal antibody specifically detects ETV7 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| ETV7 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ETS translocation variant 7, ets variant 7, ets variant gene 7 (TEL2 oncogene), TEL-2, TEL2 oncogene, TEL2ETS-related protein Tel2, TELBEts transcription factor TEL-2b, Tel-related Ets factor, transcription factor ets, transcription factor ETV7, Transcription factor Tel-2, TREF | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 51513 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title