ETV7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68687

Product Code. 18615767

Description

ETV7 Polyclonal antibody specifically detects ETV7 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: ETV7
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: ETS translocation variant 7, ets variant 7, ets variant gene 7 (TEL2 oncogene), TEL-2, TEL2 oncogene, TEL2ETS-related protein Tel2, TELBEts transcription factor TEL-2b, Tel-related Ets factor, transcription factor ets, transcription factor ETV7, Transcription factor Tel-2, TREF
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51513
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG