ERMAP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62513

Product Code. 18275541

Description

ERMAP Polyclonal specifically detects ERMAP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ERMAP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: erythroblast membrane-associated protein, erythroblast membrane-associated protein (RD and SC blood groups), erythroblast membrane-associated protein (Scianna blood group), erythroid membrane-associated protein, hERMAP, MGC118810, MGC118811, PRO2801, Radin blood group, Radin blood group (Rd), Radin blood group antigen, RDMGC118812, Scianna blood group, Scianna blood group (Sc), Scianna blood group antigen, SCMGC118813
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Dog: 79%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96PL5
• Gene Symbols: ERMAP
• Immunogen: Synthetic peptides corresponding to ERMAP(erythroblast membrane-associated protein (Scianna blood group)) The peptide sequence was selected from the middle region of ERMAP. Peptide sequence PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114625
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.