missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERK5/BMK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | ERK5/BMK1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18286411
|
Novus Biologicals
NBP2-58369 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606286
|
Novus Biologicals
NBP2-58369-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ERK5/BMK1 Polyclonal specifically detects ERK5/BMK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ERK5/BMK1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Signal Transduction | |
| Big MAP kinase 1, BMK-1, BMK1 kinase, BMK1EC 2.7.11.24, EC 2.7.11, ERK-5, ERK5MAPK 7, Extracellular signal-regulated kinase 5, extracellular-signal-regulated kinase 5, MAP kinase 7, mitogen-activated protein kinase 7, PRKM7ERK4 | |
| MAPK7 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5598 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title