ERK5/BMK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58369-25ul

Product Code. 18606286

Description

ERK5/BMK1 Polyclonal specifically detects ERK5/BMK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ERK5/BMK1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Big MAP kinase 1, BMK-1, BMK1 kinase, BMK1EC 2.7.11.24, EC 2.7.11, ERK-5, ERK5MAPK 7, Extracellular signal-regulated kinase 5, extracellular-signal-regulated kinase 5, MAP kinase 7, mitogen-activated protein kinase 7, PRKM7ERK4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MAPK7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Signal Transduction
• Gene ID (Entrez): 5598
• Target Species: Human
• Isotype: IgG

For Research Use Only