missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERK4/MAPK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ERK4/MAPK4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ERK4/MAPK4 Polyclonal specifically detects ERK4/MAPK4 in Human samples. It is validated for Western Blot.Specifications
| ERK4/MAPK4 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| EC 2.7.11, EC 2.7.11.24, ERK3, Erk3-related, Erk4, ERK-4, Extracellular signal-regulated kinase 4, MAP kinase 4, MAP kinase isoform p63, MAPK 4, mitogen-activated protein kinase 4, p63MAPK, PRKM4p63-MAPK | |
| MAPK4 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P31152 | |
| 5596 | |
| Synthetic peptides corresponding to MAPK4(mitogen-activated protein kinase 4) The peptide sequence was selected from the middle region of MAPK4. Peptide sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title