ERK4/MAPK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58082

Product Code. 18211043

Description

ERK4/MAPK4 Polyclonal specifically detects ERK4/MAPK4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ERK4/MAPK4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.24, ERK3, Erk3-related, Erk4, ERK-4, Extracellular signal-regulated kinase 4, MAP kinase 4, MAP kinase isoform p63, MAPK 4, mitogen-activated protein kinase 4, p63MAPK, PRKM4p63-MAPK
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Rabbit: 92%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P31152
• Gene Symbols: MAPK4
• Immunogen: Synthetic peptides corresponding to MAPK4(mitogen-activated protein kinase 4) The peptide sequence was selected from the middle region of MAPK4. Peptide sequence DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 5596
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.