ERCC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54898

Product Code. 18277054

Description

ERCC8 Polyclonal specifically detects ERCC8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ERCC8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CKN1DNA excision repair protein ERCC-8, Cockayne syndrome 1 (classical), Cockayne syndrome WD repeat protein CSA, CSACockayne syndrome WD-repeat protein CSA, excision repair cross-complementing rodent repair deficiency, complementationgroup 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 1161
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13216
• Gene Symbols: ERCC8
• Immunogen: Synthetic peptides corresponding to ERCC8(excision repair cross-complementing rodent repair deficiency, complementation group 8) The peptide sequence was selected from the middle region of ERCC8. Peptide sequence FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.