missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ERAS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ERAS Polyclonal specifically detects ERAS in Mouse samples. It is validated for Western Blot.Specifications
| ERAS | |
| Polyclonal | |
| Rabbit | |
| NP_853526 | |
| 3266 | |
| Synthetic peptide directed towards the N terminal of human ErasThe immunogen for this antibody is Eras. Peptide sequence LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Embryonic stem cell-expressed Ras, E-Ras, ES cell expressed Ras, HRAS2MGC126693, HRASPGTPase ERas, MGC126691, small GTPase protein E-Ras, v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2, v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene | |
| ERAS | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title