ERAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79602

Product Code. 18218325

Description

ERAS Polyclonal specifically detects ERAS in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ERAS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Embryonic stem cell-expressed Ras, E-Ras, ES cell expressed Ras, HRAS2MGC126693, HRASPGTPase ERas, MGC126691, small GTPase protein E-Ras, v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2, v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_853526
• Gene Symbols: ERAS
• Immunogen: Synthetic peptide directed towards the N terminal of human ErasThe immunogen for this antibody is Eras. Peptide sequence LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3266
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG