missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Epsilon 1 Tubulin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Epsilon 1 Tubulin |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Epsilon 1 Tubulin Polyclonal specifically detects Epsilon 1 Tubulin in Human, Drosophila samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Epsilon 1 Tubulin | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Cell Cycle and Replication, Cytoskeleton Markers, Tumor Suppressors | |
| dJ142L7.2, Epsilon-tubulin, FLJ22589, FLJ44203, TUBEepsilon-tubulin, tubulin epsilon chain, tubulin, epsilon 1 | |
| TUBE1 | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q9UJT0 | |
| 51175 | |
| Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title