Epsilon 1 Tubulin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-58223

Product Code. 18251104

Description

Epsilon 1 Tubulin Polyclonal specifically detects Epsilon 1 Tubulin in Human, Drosophila samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Epsilon 1 Tubulin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ142L7.2, Epsilon-tubulin, FLJ22589, FLJ44203, TUBEepsilon-tubulin, tubulin epsilon chain, tubulin, epsilon 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Rabbit: 92%; Equine: 85%; Xenopus: 78%; Pig: 78%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Canine, Drosophila, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9UJT0
• Gene Symbols: TUBE1
• Immunogen: Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA.
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Cytoskeleton Markers, Tumor Suppressors
• Gene ID (Entrez): 51175
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.