missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPS8L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Spezifikation
| Antigen | EPS8L1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Beschreibung
EPS8L1 Polyclonal specifically detects EPS8L1 in Human samples. It is validated for Western Blot.Spezifikation
| EPS8L1 | |
| Polyclonal | |
| Rabbit | |
| Q8TE68 | |
| 54869 | |
| Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DRC3EPS8R1, epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1, EPS8-like 1, EPS8-like protein 1, EPS8-related protein 1, FLJ20258, MGC23164, MGC4642 | |
| EPS8L1 | |
| IgG |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts