EPS8L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56615

Product Code. 18258492

Description

EPS8L1 Polyclonal specifically detects EPS8L1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EPS8L1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DRC3EPS8R1, epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1, EPS8-like 1, EPS8-like protein 1, EPS8-related protein 1, FLJ20258, MGC23164, MGC4642
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54869
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TE68
• Gene Symbols: EPS8L1
• Immunogen: Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Bovine: 92%; Mouse: 92%; Zebrafish: 92%; Guinea pig: 85%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG