missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPHX2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | EPHX2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
30226711
|
Novus Biologicals
NBP3-33234-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227806
|
Novus Biologicals
NBP3-33234-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
EPHX2 Monoclonal antibody specifically detects EPHX2 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| EPHX2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 2053 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| CEH, Cytosolic epoxide hydrolase, EC 3.3.2.10, Epoxide hydratase, epoxide hydrolase 2, epoxide hydrolase 2, cytoplasmic, epoxide hydrolase 2, cytosolic, epoxide hydrolase, soluble, SEH, Soluble epoxide hydrolase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913).,, Sequence:, MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts