missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPHX2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33234-20ul
This item is not returnable.
View return policy
Description
EPHX2 Monoclonal antibody specifically detects EPHX2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| EPHX2 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| CEH, Cytosolic epoxide hydrolase, EC 3.3.2.10, Epoxide hydratase, epoxide hydrolase 2, epoxide hydrolase 2, cytoplasmic, epoxide hydrolase 2, cytosolic, epoxide hydrolase, soluble, SEH, Soluble epoxide hydrolase | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913).,, Sequence:, MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK | |
| 20 μL | |
| Lipid and Metabolism | |
| 2053 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Ser du en mulighed for forbedring?Del en indholdskorrektion