EphA8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84893

Product Code. 18282638

Description

EphA8 Polyclonal specifically detects EphA8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EphA8
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: EEK, EK3, EPH- and ELK-related kinase, EPH- and ELK-related tyrosine kinase, EPH receptor A8, EPH-like kinase 3, ephrin type-A receptor 8, HEK3, hydroxyaryl-protein kinase, KIAA1459, protein-tyrosine kinase, tyrosine-protein kinase receptor EEK, tyrosylprotein kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EPHA8
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
• Quantity: 0.1 mL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 2046
• Target Species: Human
• Isotype: IgG

For Research Use Only