missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EphA8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £470.00
Specifications
| Antigen | EphA8 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18400001
|
Novus Biologicals
NBP1-84893-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18282638
|
Novus Biologicals
NBP1-84893 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EphA8 Polyclonal specifically detects EphA8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EphA8 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EEK, EK3, EPH- and ELK-related kinase, EPH- and ELK-related tyrosine kinase, EPH receptor A8, EPH-like kinase 3, ephrin type-A receptor 8, HEK3, hydroxyaryl-protein kinase, KIAA1459, protein-tyrosine kinase, tyrosine-protein kinase receptor EEK, tyrosylprotein kinase | |
| EPHA8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2046 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title